Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnq2 Rabbit Polyclonal Antibody (FITC)

Kcnq2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KQT2, HNSPC, Nmf13, Nmf134

UniProt

E9PZW1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001006679

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN15 Polyclonal Antibody, Biotin Conjugated
A50128-100 100 µL

CLDN15 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ZNF484 Antibody, HRP conjugated
A38985-50UG 50 µg

ZNF484 Antibody, HRP conjugated

Sign In for Pricing
View Details
CIRH1A Protein Vector (Rat) (pPB-N-His)
PV260123 500 ng

CIRH1A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
POU2F1, ID (POU2F1, OCT1, OTF1, POU domain, class 2, transcription factor 1, NF-A1, Octamer-binding protein 1, Octamer-binding transcription factor 1) (MaxLight 650) discontinued
040285-ML650 100 µL

POU2F1, ID (POU2F1, OCT1, OTF1, POU domain, class 2, transcription factor 1, NF-A1, Octamer-binding protein 1, Octamer-binding transcription factor 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CDC20B Protein Vector (Human) (pPB-N-His)
PV008642 500 ng

CDC20B Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Myeov2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3530704 1.0 µg DNA

Myeov2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details