Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnq2 Rabbit Polyclonal Antibody (HRP)

Kcnq2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KQT2, HNSPC, Nmf13, Nmf134

UniProt

E9PZW1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001006679

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF640R conjugate, 0.1mg/mL
BNC403640-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slc9a5 Mouse Gene Knockout Kit (CRISPR)
KN516212 1 Kit

Slc9a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Mrpl42 (NM_026065) Mouse Tagged ORF Clone
MG200919 10 µg

Mrpl42 (NM_026065) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TFAP2D Human Gene Knockout Kit (CRISPR)
KN416610 1 Kit

TFAP2D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details