Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnq3 Rabbit Polyclonal Antibody (Biotin)

Kcnq3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8K3F6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_690887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf178 Protein Vector (Human) (pPB-His-GST)
PV328835 500 ng

C14orf178 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Rat pigment epithelium-derived factor (PEDF) ELISA Kit
QY-E11109 96 Tests

Rat pigment epithelium-derived factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
MTMR14 CRISPRa sgRNA lentivector (set of three targets)(Rat)
30907126 3x 1.0µg DNA

MTMR14 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Olr1106 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
33676156 3x 1.0 µg DNA

Olr1106 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (MaxLight 405) discontinued
132232-ML405 100 µL

RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TRIM21 Antibody [G17P6]
C15236-100uL*2 2x 100μL

TRIM21 Antibody [G17P6]

Sign In for Pricing
View Details