Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Rabbit Polyclonal Antibody (HRP)

CLIC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95833

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hepatocyte growth factor receptor, HGFR ELISA Kit
MBS164239-01 48 Well

Human hepatocyte growth factor receptor, HGFR ELISA Kit

Sign In for Pricing
View Details
Human hepatocyte growth factor receptor, HGFR ELISA Kit
MBS164239-02 96 Well

Human hepatocyte growth factor receptor, HGFR ELISA Kit

Sign In for Pricing
View Details
Human hepatocyte growth factor receptor, HGFR ELISA Kit
MBS164239-03 5x 96 Well

Human hepatocyte growth factor receptor, HGFR ELISA Kit

Sign In for Pricing
View Details
Human hepatocyte growth factor receptor, HGFR ELISA Kit
MBS164239-04 10x 96 Well

Human hepatocyte growth factor receptor, HGFR ELISA Kit

Sign In for Pricing
View Details
Klb Mouse Gene Knockout Kit (CRISPR)
KN508817 1 Kit

Klb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BX-912 2mg
A11149-2 2 mg

BX-912 2mg

Sign In for Pricing
View Details