Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnd1 Rabbit Polyclonal Antibody (Biotin)

Kcnd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, mSh, Kv4., Shal, Kca2-, Kv4.1, Shal1, Kca2-1, mShal1, 1110037K09Rik

UniProt

Q03719

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BICC1 Human Gene Knockout Kit (CRISPR)
KN416626 1 Kit

BICC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Green, Elab Fluor® 488)
E-CK-A421-01 20 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Green, Elab Fluor® 488)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Green, Elab Fluor® 488)
E-CK-A421-02 100 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Green, Elab Fluor® 488)

Sign In for Pricing
View Details
Succinimidyl 3-(Tri-n-butylstannyl)benzoate
TRC-S692038-1G 1 g

Succinimidyl 3-(Tri-n-butylstannyl)benzoate

Sign In for Pricing
View Details
Human ALLC activation kit by CRISPRa
GA110997 1 Kit

Human ALLC activation kit by CRISPRa

Sign In for Pricing
View Details
AHSG Antibody
KC-2435-01 50 μL

AHSG Antibody

Sign In for Pricing
View Details