Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RXL1 Rabbit Polyclonal Antibody (HRP)

P2RXL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2X6, P2XM, P2RXL1

UniProt

O15547

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human P2RXL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005437

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF κB P49 mouse monoclonal antibody
TD-ABY1068 100 µg

NF κB P49 mouse monoclonal antibody

Sign In for Pricing
View Details
BBS10 Adenovirus (Rat)
13036056 1.0 mL

BBS10 Adenovirus (Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal CTLA-4 Antibody (2188B) [Janelia Fluor 525]
FAB3253JF525 0.1 mL

Rabbit Monoclonal CTLA-4 Antibody (2188B) [Janelia Fluor 525]

Sign In for Pricing
View Details
EWSR1, CT (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (MaxLight 550) discontinued
E9002-85H-ML550 100 µL

EWSR1, CT (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) ELISA Kit
MBS7210795-01 48 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) ELISA Kit

Sign In for Pricing
View Details
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) ELISA Kit
MBS7210795-02 96 Well

Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) ELISA Kit

Sign In for Pricing
View Details