Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (FITC)

P2RX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_036358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin (Ob, Obese Protein, Obesity Factor)
377884-01 50 µL

Leptin (Ob, Obese Protein, Obesity Factor)

Sign In for Pricing
View Details
Leptin (Ob, Obese Protein, Obesity Factor)
377884-02 100 µL

Leptin (Ob, Obese Protein, Obesity Factor)

Sign In for Pricing
View Details
Tshz1, ID (Tshz1, Kiaa4206, Sdccag33, Tsh1, Teashirt homolog 1, Serologically defined colon cancer antigen 3 homolog) (Biotin)
MBS6359498-01 0.2 mL

Tshz1, ID (Tshz1, Kiaa4206, Sdccag33, Tsh1, Teashirt homolog 1, Serologically defined colon cancer antigen 3 homolog) (Biotin)

Sign In for Pricing
View Details
Tshz1, ID (Tshz1, Kiaa4206, Sdccag33, Tsh1, Teashirt homolog 1, Serologically defined colon cancer antigen 3 homolog) (Biotin)
MBS6359498-02 5x 0.2 mL

Tshz1, ID (Tshz1, Kiaa4206, Sdccag33, Tsh1, Teashirt homolog 1, Serologically defined colon cancer antigen 3 homolog) (Biotin)

Sign In for Pricing
View Details
METTL1 (tRNA (guanine-N (7) -) -methyltransferase, Methyltransferase-like Protein 1, tRNA (guanine (46) -N (7) ) -methyltransferase, tRNA (m7G46) -methyltransferase, C12orf1, FLJ95748, TRM8, YDL201w) (PE)
138124-PE 100 µL

METTL1 (tRNA (guanine-N (7) -) -methyltransferase, Methyltransferase-like Protein 1, tRNA (guanine (46) -N (7) ) -methyltransferase, tRNA (m7G46) -methyltransferase, C12orf1, FLJ95748, TRM8, YDL201w) (PE)

Sign In for Pricing
View Details
LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (PE)
037781-PE 200 µL

LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (PE)

Sign In for Pricing
View Details