Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC4 Rabbit Polyclonal Antibody (HRP)

CLIC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H1, huH1, p64H1, CLIC4L, MTCLIC

UniProt

Q5VSX5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_039234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filensin Lentiviral Activation Particles (h)
sc-410703-LAC 200 µL

Filensin Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Cytochrome P450 2D6 Antibody
orb1423717 100 µL

Cytochrome P450 2D6 Antibody

Sign In for Pricing
View Details
JNJ-632 10mg
A20182-10 10 mg

JNJ-632 10mg

Sign In for Pricing
View Details
Rat Apolipoprotein C2 (APOC2) ELISA Kit
RD-APOC2-Ra-96Tests 96 Tests

Rat Apolipoprotein C2 (APOC2) ELISA Kit

Sign In for Pricing
View Details
FBXL14 Antibody Blocking Peptide
orb1511365 500 µg

FBXL14 Antibody Blocking Peptide

Sign In for Pricing
View Details
4-Aminophenyl Alpha-D-Mannopyranoside
TRC-A624995-100MG 100 mg

4-Aminophenyl Alpha-D-Mannopyranoside

Sign In for Pricing
View Details