Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC4 Rabbit Polyclonal Antibody (Biotin)

CLIC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H1, huH1, p64H1, CLIC4L, MTCLIC

UniProt

Q5VSX5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_039234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat syncytin-1 (syncytin-1) ELISA Kit
YP-W37981-01 48 Tests

Rat syncytin-1 (syncytin-1) ELISA Kit

Sign In for Pricing
View Details
Rat syncytin-1 (syncytin-1) ELISA Kit
YP-W37981-02 96 Tests

Rat syncytin-1 (syncytin-1) ELISA Kit

Sign In for Pricing
View Details
Bovine Syntaxin 1B (STX1B) ELISA Kit
MBS9392252-01 48 Well

Bovine Syntaxin 1B (STX1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Syntaxin 1B (STX1B) ELISA Kit
MBS9392252-02 96 Well

Bovine Syntaxin 1B (STX1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Syntaxin 1B (STX1B) ELISA Kit
MBS9392252-03 5x 96 Well

Bovine Syntaxin 1B (STX1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Syntaxin 1B (STX1B) ELISA Kit
MBS9392252-04 10x 96 Well

Bovine Syntaxin 1B (STX1B) ELISA Kit

Sign In for Pricing
View Details