Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG4 Rabbit Polyclonal Antibody (HRP)

CACNG4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC11138, MGC24983

UniProt

Q9UBN1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MAGEB18 Antibody (OTI1F5) [DyLight 755]
NBP2-72575IR 0.1 mL

Mouse Monoclonal MAGEB18 Antibody (OTI1F5) [DyLight 755]

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM107 Antibody [DyLight 680]
NBP2-81865FR 0.1 mL

Rabbit Polyclonal TMEM107 Antibody [DyLight 680]

Sign In for Pricing
View Details
Brd2 (NM_212495) Rat Tagged ORF Clone
RR211139 10 µg

Brd2 (NM_212495) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ELAC2 Protein Lysate (Human) with C-Ha Tag
19193031 100 µg

ELAC2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
OR2L8 rabbit pAb
ES11559-01 50 µL

OR2L8 rabbit pAb

Sign In for Pricing
View Details
OR2L8 rabbit pAb
ES11559-02 100 µL

OR2L8 rabbit pAb

Sign In for Pricing
View Details