Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNMB4 Rabbit Polyclonal Antibody (HRP)

KCNMB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86W47

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_055320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BEND6 activation kit by CRISPRa
GA116609 1 Kit

Human BEND6 activation kit by CRISPRa

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), Biotin conjugate, 0.1mg/mL
BNCB2085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]
TA505424AM 100 µL

KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]

Sign In for Pricing
View Details
Allophycocyanin (APC), cross-linked lyophilized solid, ammonium sulfate free
#29092-1000mg 10x 100 mg

Allophycocyanin (APC), cross-linked lyophilized solid, ammonium sulfate free

Sign In for Pricing
View Details
Recombinant Human Interleukin-17A/IL-17A Protein (Human Cells, His Tag)
PKSH032621-01 10 µg

Recombinant Human Interleukin-17A/IL-17A Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human Interleukin-17A/IL-17A Protein (Human Cells, His Tag)
PKSH032621-02 50 µg

Recombinant Human Interleukin-17A/IL-17A Protein (Human Cells, His Tag)

Sign In for Pricing
View Details