Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd3 Rabbit Polyclonal Antibody (HRP)

Kctd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NY-REN, NY-REN-45, 9330185B06, 4930438A20Rik, E330032J19Rik

UniProt

Q8BFX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVSGNWIEIAYGTSSGAVR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228D-01 50 Tests

PE Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details
PE Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228D-02 100 Tests

PE Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details
PE Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228D-03 2x 100 Tests

PE Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details
Dispensing Booth BAIP-105
BAIP-105 1 Unit

Dispensing Booth BAIP-105

Sign In for Pricing
View Details
Teicoplanin A2 (Mixture of 2-1, 2-2, 2-3, 2-4 and 2-5)
TRC-T015500-250MG 250 mg

Teicoplanin A2 (Mixture of 2-1, 2-2, 2-3, 2-4 and 2-5)

Sign In for Pricing
View Details
FSH beta Polyclonal Antibody
E-AB-40593-01 25 µL

FSH beta Polyclonal Antibody

Sign In for Pricing
View Details