Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd3 Rabbit Polyclonal Antibody (HRP)

Kctd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NY-REN, NY-REN-45, 9330185B06, 4930438A20Rik, E330032J19Rik

UniProt

Q8BFX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVSGNWIEIAYGTSSGAVR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanthus nivalis Gel -GNA- Immobilized Lectin
A-7401-2 2 mL

Galanthus nivalis Gel -GNA- Immobilized Lectin

Sign In for Pricing
View Details
Mouse Eed activation kit by CRISPRa
GA201184 1 Kit

Mouse Eed activation kit by CRISPRa

Sign In for Pricing
View Details
Hydroxy Acetildenafil-d4
TRC-H739942-25MG 25 mg

Hydroxy Acetildenafil-d4

Sign In for Pricing
View Details
GASK1A Human Gene Knockout Kit (CRISPR)
KN425972 1 Kit

GASK1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DIRAS1 Polyclonal Antibody
E-AB-13199-01 20 µL

DIRAS1 Polyclonal Antibody

Sign In for Pricing
View Details
DIRAS1 Polyclonal Antibody
E-AB-13199-02 60 µL

DIRAS1 Polyclonal Antibody

Sign In for Pricing
View Details