Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (FITC)

P2RX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human P2RX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_777361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYGD 3'UTR GFP Stable Cell Line
TU055068 1.0 mL

CRYGD 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HRH1 3'UTR GFP Stable Cell Line
TU060161 1.0 mL

HRH1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospholipase A2, Calcium Independent (iPLA2) BioAssayTM ELISA Kit (Rat) discontinued
027426-01 48 Tests

Phospholipase A2, Calcium Independent (iPLA2) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Phospholipase A2, Calcium Independent (iPLA2) BioAssayTM ELISA Kit (Rat) discontinued
027426-02 96 Tests

Phospholipase A2, Calcium Independent (iPLA2) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)
MBS2169458-01 0.1 mL

Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)

Sign In for Pricing
View Details
Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)
MBS2169458-02 0.2 mL

Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)

Sign In for Pricing
View Details