Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK9 Rabbit Polyclonal Antibody (FITC)

KCNK9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32

UniProt

Q9NPC2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057685

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Ligand Superfamily Member 4 (CD252) Antibody (PerCP)
abx200741-01 25 µg

Tumor Necrosis Factor Ligand Superfamily Member 4 (CD252) Antibody (PerCP)

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 4 (CD252) Antibody (PerCP)
abx200741-02 100 µg

Tumor Necrosis Factor Ligand Superfamily Member 4 (CD252) Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)
TRV-0054352-01 10 µg

Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)

Sign In for Pricing
View Details
Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)
TRV-0054352-02 50 µg

Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)

Sign In for Pricing
View Details
Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)
TRV-0054352-03 100 µg

Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)

Sign In for Pricing
View Details
Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)
TRV-0054352-04 200 µg

Recombinant Ubiquitin Like Modifier Activating Enzyme 6 (UBA6)

Sign In for Pricing
View Details