Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC5 Rabbit Polyclonal Antibody (FITC)

CLIC5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MST130, DFNB102, DFNB103, MSTP130

UniProt

Q9NZA1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_058625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae UPF0508 protein SCY_2952 (SCY_2952), partial
MBS1251795 Inquire

Recombinant Saccharomyces cerevisiae UPF0508 protein SCY_2952 (SCY_2952), partial

Sign In for Pricing
View Details
MPP5 sgRNA CRISPR Lentivector set (Human)
K1321301 3x 1.0 µg

MPP5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human ING1 Pre-designed siRNA Set B
SI007660B 1 Each

Human ING1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GRIP1 (Glucocorticoid Receptor Interacting Protein 1, GRIP-1, BHLHE75, KAT13C, MGC138808, Nuclear Receptor Coactivator 2, NCoA2, NCoA-2, Steroid Receptor Coactivator 2, SRC-2, src2, Transcriptional Intermediary Factor 2, TIF2) (APC) discontinued
G8970-03G-APC 100 µL

GRIP1 (Glucocorticoid Receptor Interacting Protein 1, GRIP-1, BHLHE75, KAT13C, MGC138808, Nuclear Receptor Coactivator 2, NCoA2, NCoA-2, Steroid Receptor Coactivator 2, SRC-2, src2, Transcriptional Intermediary Factor 2, TIF2) (APC) discontinued

Sign In for Pricing
View Details
Recombinant human PF4V1/CXCL4L1 protein
ATGP2655-010 10 µg

Recombinant human PF4V1/CXCL4L1 protein

Sign In for Pricing
View Details
Ncf1-set siRNA/shRNA/RNAi Lentivector (Mouse)
31550094 4x 500 ng

Ncf1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details