Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC5 Rabbit Polyclonal Antibody (FITC)

CLIC5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MST130, DFNB102, DFNB103, MSTP130

UniProt

Q9NZA1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_058625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dinoroseobacter shibae Cell division protein FtsQ (ftsQ), partial
MBS1172872-01 1 mg (E-Coli)

Recombinant Dinoroseobacter shibae Cell division protein FtsQ (ftsQ), partial

Sign In for Pricing
View Details
Recombinant Dinoroseobacter shibae Cell division protein FtsQ (ftsQ), partial
MBS1172872-02 1 mg (Yeast)

Recombinant Dinoroseobacter shibae Cell division protein FtsQ (ftsQ), partial

Sign In for Pricing
View Details
SERPINA11 Antibody
E037915 100 µg -100 µL

SERPINA11 Antibody

Sign In for Pricing
View Details
Mouse Rxrb (BC019432) AAV Particle
MR206527A1V 250 µL

Mouse Rxrb (BC019432) AAV Particle

Sign In for Pricing
View Details
Rat ADAMTS like protein 4 (ADAMTSL4) ELISA Kit
GTR10352629 96 Well

Rat ADAMTS like protein 4 (ADAMTSL4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human GDNF Receptor α-2/GFRA2 (C-Fc-6His)
CJ30-1mg 1 mg

Recombinant Human GDNF Receptor α-2/GFRA2 (C-Fc-6His)

Sign In for Pricing
View Details