Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnj16 Rabbit Polyclonal Antibody (FITC)

Kcnj16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Kir5.1

UniProt

Q68G21

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Kcnj16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_445766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mef2a shRNA (UAS) - Lentiviral mouse Mef2a shRNA (UAS) plasmid
GTR15283303 1 Vial

Lentiviral mouse Mef2a shRNA (UAS) - Lentiviral mouse Mef2a shRNA (UAS) plasmid

Sign In for Pricing
View Details
ZSCAN26 (Zinc Finger and SCAN Domain-containing Protein 26, Protein SRE-ZBP, Zinc Finger Protein 187, ZNF187) (FITC)
MBS6150553-01 0.1 mL

ZSCAN26 (Zinc Finger and SCAN Domain-containing Protein 26, Protein SRE-ZBP, Zinc Finger Protein 187, ZNF187) (FITC)

Sign In for Pricing
View Details
ZSCAN26 (Zinc Finger and SCAN Domain-containing Protein 26, Protein SRE-ZBP, Zinc Finger Protein 187, ZNF187) (FITC)
MBS6150553-02 5x 0.1 mL

ZSCAN26 (Zinc Finger and SCAN Domain-containing Protein 26, Protein SRE-ZBP, Zinc Finger Protein 187, ZNF187) (FITC)

Sign In for Pricing
View Details
ASCC1 Recombinant Protein (Rat)
RP191165 100 µg

ASCC1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
GRK6P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
22687061 1.0 µg DNA

GRK6P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OR7E43P sgRNA CRISPR Lentivector (Human) (Target 2)
K1535803 1.0 µg DNA

OR7E43P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details