Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA10 Rabbit Polyclonal Antibody (HRP)

CHRNA10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9GZZ6

Immunogen

The immunogen for Anti-CHRNA10 antibody is: synthetic peptide directed towards the N-terminal region of Human ACH10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQT

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065135.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Slit homolog 3 protein (SLIT3) ELISA Kit
YP-W18989-01 48 Tests

Human Slit homolog 3 protein (SLIT3) ELISA Kit

Sign In for Pricing
View Details
Human Slit homolog 3 protein (SLIT3) ELISA Kit
YP-W18989-02 96 Tests

Human Slit homolog 3 protein (SLIT3) ELISA Kit

Sign In for Pricing
View Details
FGF-R4/CD334 His Tag Protein, Human
UA020009-01 25 µg

FGF-R4/CD334 His Tag Protein, Human

Sign In for Pricing
View Details
FGF-R4/CD334 His Tag Protein, Human
UA020009-02 50 µg

FGF-R4/CD334 His Tag Protein, Human

Sign In for Pricing
View Details
FGF-R4/CD334 His Tag Protein, Human
UA020009-03 100 µg

FGF-R4/CD334 His Tag Protein, Human

Sign In for Pricing
View Details
FGF-R4/CD334 His Tag Protein, Human
UA020009-04 500 µg

FGF-R4/CD334 His Tag Protein, Human

Sign In for Pricing
View Details