Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ12 Rabbit Polyclonal Antibody (Biotin)

KCNJ12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, Kir2.2v, kcnj12x, hkir2.2x

UniProt

Q14500

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNJ12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_066292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aftph (NM_001290545) Mouse Untagged Clone
MC229188 10 µg

Aftph (NM_001290545) Mouse Untagged Clone

Sign In for Pricing
View Details
IP6K1 3'UTR Luciferase Stable Cell Line
TU011212 1.0 mL

IP6K1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant High Mobility Group Protein 1 (HMGB1)
TRV-0014323-01 10 µg

Recombinant High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Recombinant High Mobility Group Protein 1 (HMGB1)
TRV-0014323-02 50 µg

Recombinant High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Recombinant High Mobility Group Protein 1 (HMGB1)
TRV-0014323-03 100 µg

Recombinant High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Recombinant High Mobility Group Protein 1 (HMGB1)
TRV-0014323-04 200 µg

Recombinant High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details