Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK10 Rabbit Polyclonal Antibody (FITC)

KCNK10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TREK2, TREK-2, K2p10.1, PPP1R97

UniProt

P57789

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AP1M2 activation kit by CRISPRa
GA106810 1 Kit

Human AP1M2 activation kit by CRISPRa

Sign In for Pricing
View Details
C12orf43 (NM_022895) Human Recombinant Protein
TP304834 20 µg

C12orf43 (NM_022895) Human Recombinant Protein

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) pSer486 Rabbit Polyclonal Antibody
AP20922PU-N 100 µg

AMPK alpha 1 (PRKAA1) pSer486 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®568 Monoclonal Mouse Anti-Biotin IgG, 2 mg/mL
#20502-250uL 1x 250 µL

CF®568 Monoclonal Mouse Anti-Biotin IgG, 2 mg/mL

Sign In for Pricing
View Details
XFD405 C5 maleimide
70011-AAT 1 mg

XFD405 C5 maleimide

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details