Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB2 Rabbit Polyclonal Antibody (Biotin)

GABRB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DEE92, ICEE2

UniProt

P47870

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN GABRB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF6 Antibody
F47406-0.4ML 0.4 mL

TRAF6 Antibody

Sign In for Pricing
View Details
Runx1 (Runt-Related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-Binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-Binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV core-Binding Factor alpha B Subunit, Runx1, Aml1, Cbfa2, Pebp2ab) (APC) discontinued
302721-APC 200 µL

Runx1 (Runt-Related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-Binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-Binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV core-Binding Factor alpha B Subunit, Runx1, Aml1, Cbfa2, Pebp2ab) (APC) discontinued

Sign In for Pricing
View Details
NMDA Receptor NR2B, phosphorylated (Ser1480) (NMDA R2b, NMDAR2B, N-methyl-D-aspartate, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B) (MaxLight 490) discontinued
N2904-35G-ML490 100 µL

NMDA Receptor NR2B, phosphorylated (Ser1480) (NMDA R2b, NMDAR2B, N-methyl-D-aspartate, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial
orb1647934-01 20 µg

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial

Sign In for Pricing
View Details
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial
orb1647934-02 100 µg

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial

Sign In for Pricing
View Details
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial
orb1647934-03 1 mg

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial

Sign In for Pricing
View Details