Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRE Rabbit Polyclonal Antibody (HRP)

GABRE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GABRE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]
TA807938BM 100 µL

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]

Sign In for Pricing
View Details
Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RDR-CCK8-Mu-01 96 Tests

Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RDR-CCK8-Mu-02 48 Tests

Mouse Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559237 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Chloramine-T Trihydrate
TRC-C315160-10G 10 g

Chloramine-T Trihydrate

Sign In for Pricing
View Details
PE Anti-Mouse CD27 Antibody[LG.3A10]
AN00322D-01 50 Tests

PE Anti-Mouse CD27 Antibody[LG.3A10]

Sign In for Pricing
View Details