Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRE Rabbit Polyclonal Antibody (HRP)

GABRE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GABRE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]
AM09057PU-S 50 µL

KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]

Sign In for Pricing
View Details
IGFBP6 (NM_002178) Human Recombinant Protein
TP304060L 1 mg

IGFBP6 (NM_002178) Human Recombinant Protein

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF740 conjugate, 0.1mg/mL
BNC742059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC4 Rabbit Monoclonal Antibody [Clone ID: 23GB865]
TA424844 100 µL

HDAC4 Rabbit Monoclonal Antibody [Clone ID: 23GB865]

Sign In for Pricing
View Details
Histone H2A.J (H2AFJ) Rabbit Polyclonal Antibody
TA370704 100 µL

Histone H2A.J (H2AFJ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND1 Rabbit Polyclonal Antibody
TA369486 100 µL

ZFAND1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details