Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRE Rabbit Polyclonal Antibody (Biotin)

GABRE Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GABRE

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TRPC3 Antibody Picoband®, HRP Conjugate
A01472-4-HRP 100 µg/Vial

Anti-TRPC3 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (APC)
253611-APC 100 µL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (APC)

Sign In for Pricing
View Details
Polyclonal Antibody to LC3 A
MBS668701-01 0.025 mg

Polyclonal Antibody to LC3 A

Sign In for Pricing
View Details
Polyclonal Antibody to LC3 A
MBS668701-02 0.1 mg

Polyclonal Antibody to LC3 A

Sign In for Pricing
View Details
Polyclonal Antibody to LC3 A
MBS668701-03 5x 0.1 mg

Polyclonal Antibody to LC3 A

Sign In for Pricing
View Details
Nalgene Cryovial 1.2ml
CRY8206 1000 / PCK

Nalgene Cryovial 1.2ml

Sign In for Pricing
View Details