Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXYD7 Rabbit Polyclonal Antibody (FITC)

FXYD7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ25096

UniProt

P58549

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_071289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPP Rabbit Polyclonal Antibody
orb556189 100 µL

CLPP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RBFOX3/NeuN Antibody (rNEUN/8055) [HRP]
NBP3-24074H 0.1 mL

Mouse Monoclonal RBFOX3/NeuN Antibody (rNEUN/8055) [HRP]

Sign In for Pricing
View Details
PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1, CKIP-1, OC120) (FITC)
250220-FITC 100 µL

PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1, CKIP-1, OC120) (FITC)

Sign In for Pricing
View Details
RETNLB, ID (RETNLB, CCRG, FIZZ2, HXCP2, RETNL2, Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta) (FITC) discontinued
040970-FITC 200 µL

RETNLB, ID (RETNLB, CCRG, FIZZ2, HXCP2, RETNL2, Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta) (FITC) discontinued

Sign In for Pricing
View Details
Reg3b 3'UTR GFP Stable Cell Line
TU167709 1.0 mL

Reg3b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
fast skeletal Myosin (MYLPF) (NM_013292) Human Recombinant Protein
TP303081M 100 µg

fast skeletal Myosin (MYLPF) (NM_013292) Human Recombinant Protein

Sign In for Pricing
View Details