Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK13 Rabbit Polyclonal Antibody (Biotin)

KCNK13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

THIK1, THIK-1, K2p13.1

UniProt

Q9HB14

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_071337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF740 conjugate, 0.1mg/mL
BNC742896-100 1x 100 µL

VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CASP9 Protein (Sumo Tag)
PDEH100514-01 20 µg

Recombinant Human CASP9 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP9 Protein (Sumo Tag)
PDEH100514-02 100 µg

Recombinant Human CASP9 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP9 Protein (Sumo Tag)
PDEH100514-03 500 µg

Recombinant Human CASP9 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP9 Protein (Sumo Tag)
PDEH100514-04 1 mg

Recombinant Human CASP9 Protein (Sumo Tag)

Sign In for Pricing
View Details
Cartpt (BC056431) Mouse Tagged ORF Clone
MG200711 10 µg

Cartpt (BC056431) Mouse Tagged ORF Clone

Sign In for Pricing
View Details