Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD15 Rabbit Polyclonal Antibody (HRP)

KCTD15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC25497, MGC2628

UniProt

Q96SI1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL
BNC681149-100 1x 100 µL

CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-01 24 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-02 48 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-03 96 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details