Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM8 Rabbit Polyclonal Antibody (HRP)

TRPM8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRPP8, LTRPC6, trp-p8, LTrpC-6

UniProt

Q7Z2W7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_076985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat platelet-associated Complement 3 (PAC3) ELISA Kit
EIA06164r 1 Kit

Rat platelet-associated Complement 3 (PAC3) ELISA Kit

Sign In for Pricing
View Details
IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) Rat ELISA Kit
E1701 96 Tests

IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) Rat ELISA Kit

Sign In for Pricing
View Details
Anti-Rat VEGFA Antibody (SAA0447), APC
RB941237-01 1 Each

Anti-Rat VEGFA Antibody (SAA0447), APC

Sign In for Pricing
View Details
Anti-Rat VEGFA Antibody (SAA0447), APC
RB941237-02 100 Tests

Anti-Rat VEGFA Antibody (SAA0447), APC

Sign In for Pricing
View Details
SPRR2C Protein Lysate (Human) with C-Ha Tag
45388031 100 µg

SPRR2C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
LabTie 45-Vial Bead Dispenser, 1-1.0 mm bead
LT-45-2-1-10 1 Unit

LabTie 45-Vial Bead Dispenser, 1-1.0 mm bead

Sign In for Pricing
View Details