Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM8 Rabbit Polyclonal Antibody (HRP)

TRPM8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRPP8, LTRPC6, trp-p8, LTrpC-6

UniProt

Q7Z2W7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076985.4

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal 2B4/CD244/SLAMF4 Antibody [Alexa Fluor 647]
NBP1-76558AF647 0.1 mL

Rabbit Polyclonal 2B4/CD244/SLAMF4 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Human NG2/MCSP Alexa Fluor 700 Antibody (Clone 7.1)
FAB25851N-100UG 100 µg

Human NG2/MCSP Alexa Fluor 700 Antibody (Clone 7.1)

Sign In for Pricing
View Details
Total Iron-Binding Capacity (TIBC) Colorimetric Assay Kit
orb1173198 96 Tests

Total Iron-Binding Capacity (TIBC) Colorimetric Assay Kit

Sign In for Pricing
View Details
Ethyl 2- (2-aminophenyl) acetate
PCA46085 2.5 g

Ethyl 2- (2-aminophenyl) acetate

Sign In for Pricing
View Details
Ncdn (NM_053543) Rat Untagged Clone
RN208606 10 µg

Ncdn (NM_053543) Rat Untagged Clone

Sign In for Pricing
View Details
PKN1 Polyclonal Antibody
RA34121-01 50 µL

PKN1 Polyclonal Antibody

Sign In for Pricing
View Details