Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM8 Rabbit Polyclonal Antibody (HRP)

TRPM8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRPP8, LTRPC6, trp-p8, LTrpC-6

UniProt

Q7Z2W7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076985.4

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey anti-Sheep IgG Heavy and Light Chain Antibody DyLight 488 Conjugated
MBS3900472-01 0.5 mg

Donkey anti-Sheep IgG Heavy and Light Chain Antibody DyLight 488 Conjugated

Sign In for Pricing
View Details
Donkey anti-Sheep IgG Heavy and Light Chain Antibody DyLight 488 Conjugated
MBS3900472-02 5x 0.5 mg

Donkey anti-Sheep IgG Heavy and Light Chain Antibody DyLight 488 Conjugated

Sign In for Pricing
View Details
Hcn3 Mouse shRNA Plasmid (Locus ID 15168)
TR517355 1 Kit

Hcn3 Mouse shRNA Plasmid (Locus ID 15168)

Sign In for Pricing
View Details
Tri-6 (Z),9 (Z),12 (Z) -octadecatrienoin
KCA75674-01 500 mg

Tri-6 (Z),9 (Z),12 (Z) -octadecatrienoin

Sign In for Pricing
View Details
Tri-6 (Z),9 (Z),12 (Z) -octadecatrienoin
KCA75674-02 1000 mg

Tri-6 (Z),9 (Z),12 (Z) -octadecatrienoin

Sign In for Pricing
View Details
Lentiviral mouse Mfge8 shRNA (UAS) - Lentiviral mouse Mfge8 shRNA (UAS, RFP) (25)
GTR15189551 1 Vial

Lentiviral mouse Mfge8 shRNA (UAS) - Lentiviral mouse Mfge8 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details