Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH6 Rabbit Polyclonal Antibody (HRP)

KCNH6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERG2, ERG-2, HERG2, Kv11.2, hERG-2

UniProt

Q9H252

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_775115

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human SARS-CoV-2 (Covid-19) Membrane Protein Antigen Quantitative TITRATION ELISA
KBVH015-31 1x 96 Well

GENLISA™ Human SARS-CoV-2 (Covid-19) Membrane Protein Antigen Quantitative TITRATION ELISA

Sign In for Pricing
View Details
Anti-MAD2L1BP Antibody (R2F85)
RHG97301 100 μg

Anti-MAD2L1BP Antibody (R2F85)

Sign In for Pricing
View Details
HIST1H4A (Ab-12) Polyclonal Antibody
CAC15206-01 50 µL

HIST1H4A (Ab-12) Polyclonal Antibody

Sign In for Pricing
View Details
HIST1H4A (Ab-12) Polyclonal Antibody
CAC15206-02 100 µL

HIST1H4A (Ab-12) Polyclonal Antibody

Sign In for Pricing
View Details
IDH3G (Isocitrate Dehydrogenase [NAD] Subunit gamma, Mitochondrial, Isocitric Dehydrogenase Subunit gamma, NAD (+) -specific ICDH Subunit gamma) (HRP)
128213-HRP 100 µL

IDH3G (Isocitrate Dehydrogenase [NAD] Subunit gamma, Mitochondrial, Isocitric Dehydrogenase Subunit gamma, NAD (+) -specific ICDH Subunit gamma) (HRP)

Sign In for Pricing
View Details
NARG1L CRISPR Activation Plasmid (m2)
sc-426253-ACT-2 20 µg

NARG1L CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details