Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH6 Rabbit Polyclonal Antibody (HRP)

KCNH6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERG2, ERG-2, HERG2, Kv11.2, hERG-2

UniProt

Q9H252

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_110406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYGM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D1]
TA811300AM 100 µL

PYGM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D1]

Sign In for Pricing
View Details
PPP3CC (N-term) Rabbit Polyclonal Antibody
AP53421PU-N 400 µL

PPP3CC (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]
TA500915BM 100 µL

RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]

Sign In for Pricing
View Details
Plant Cell Compartment Antibody Marker Set | 10 antibodies
SA000003 1 Each

Plant Cell Compartment Antibody Marker Set | 10 antibodies

Sign In for Pricing
View Details
RBM41 Human Gene Knockout Kit (CRISPR)
KN402673 1 Kit

RBM41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF405S conjugate, 0.1mg/mL
BNC040873-100 1x 100 µL

P34 / cdk1 (CDK1/873), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details