Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA7 Rabbit Polyclonal Antibody (Biotin)

KCNA7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HAK6, KV1.7

UniProt

Q96RP8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNA7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_114092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP 1 (Vesicle Associated Membrane Protein 1, Vesicle-associated Membrane Protein 1, VAMP1, VAMP-1, Synaptobrevin 1, Synaptobrevin-1, SYB1, SYB-1)
V2024-01B 100 µg

VAMP 1 (Vesicle Associated Membrane Protein 1, Vesicle-associated Membrane Protein 1, VAMP1, VAMP-1, Synaptobrevin 1, Synaptobrevin-1, SYB1, SYB-1)

Sign In for Pricing
View Details
FMO1 Antibody
orb1178303 100 µg

FMO1 Antibody

Sign In for Pricing
View Details
S100A5 Antibody / S100 calcium binding protein A5
V4727-20UG 20 µg

S100A5 Antibody / S100 calcium binding protein A5

Sign In for Pricing
View Details
Rhof CRISPR All-in-one AAV vector set (with saCas9)(Human)
39517151 3x 1.0 µg DNA

Rhof CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
WNT16 siRNA (Human)
CRH9738-01 15 nmol

WNT16 siRNA (Human)

Sign In for Pricing
View Details
WNT16 siRNA (Human)
CRH9738-02 30 nmol

WNT16 siRNA (Human)

Sign In for Pricing
View Details