Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA7 Rabbit Polyclonal Antibody (Biotin)

KCNA7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HAK6, KV1.7

UniProt

Q96RP8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNA7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_114092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHFR Protein Vector (Human) (pPB-N-His)
PV069346 500 ng

CHFR Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Alpha-glucosides permease MPH2 (MPH2) , partial
MBS1198610-01 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Alpha-glucosides permease MPH2 (MPH2) , partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Alpha-glucosides permease MPH2 (MPH2) , partial
MBS1198610-02 1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Alpha-glucosides permease MPH2 (MPH2) , partial

Sign In for Pricing
View Details
Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit
CK-bio-10973-01 48 Tests

Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit

Sign In for Pricing
View Details
Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit
CK-bio-10973-02 96 Tests

Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit

Sign In for Pricing
View Details
Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit
CK-bio-10973-03 5x 96 Tests

Human T-lymphocyte activation antigen CD86, CD86 ELISA Kit

Sign In for Pricing
View Details