Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG6 Rabbit Polyclonal Antibody (HRP)

CACNG6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BXT2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_665813

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Butoconazole-d5 Nitrate
TRC-B690272-1MG 1 mg

rac Butoconazole-d5 Nitrate

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-01 24 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-02 48 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details
Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit
E-EL-H3651-03 96 Tests

Human TWEAK (Tumour Necrosis Factor Related Weak Inducer of Apoptosis) ELISA Kit

Sign In for Pricing
View Details
TNFAIP3 Recombinant Rabbit Monoclonal Antibody [SN07-31]
ET1611-40 100 µL

TNFAIP3 Recombinant Rabbit Monoclonal Antibody [SN07-31]

Sign In for Pricing
View Details
2-Amino-4-fluoro-5-nitrobenzoic Acid
TRC-A632455-10MG 10 mg

2-Amino-4-fluoro-5-nitrobenzoic Acid

Sign In for Pricing
View Details