Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK10 Rabbit Polyclonal Antibody (Biotin)

KCNK10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TREK2, TREK-2, K2p10.1, PPP1R97

UniProt

P57789

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ABCF2 Antibody [Biotin]
NBP2-98976B 0.1 mL

Rabbit Polyclonal ABCF2 Antibody [Biotin]

Sign In for Pricing
View Details
GALK2 Rabbit Polyclonal Antibody (Cy7)
orb1059816 100 µL

GALK2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
UBL4A antibody
MBS834498-01 0.1 mL

UBL4A antibody

Sign In for Pricing
View Details
UBL4A antibody
MBS834498-02 5x 0.1 mL

UBL4A antibody

Sign In for Pricing
View Details
RAGE Polyclonal Antibody APC Conjugated
orb1541650 100 µL

RAGE Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
Mouse Target of rapamycin complex 2 subunit MAPKAP1 (MAPKAP1) ELISA Kit
orb1653588-01 48 Tests

Mouse Target of rapamycin complex 2 subunit MAPKAP1 (MAPKAP1) ELISA Kit

Sign In for Pricing
View Details