Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHKBP1 Rabbit Polyclonal Antibody (HRP)

SHKBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sb1, PP203

UniProt

Q8TBC3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHKBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_612401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS710834 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
E2F6 Rabbit Monoclonal Antibody
TA423503 100 µL

E2F6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit
E-EL-H2072-01 24 Tests

Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit

Sign In for Pricing
View Details
Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit
E-EL-H2072-02 48 Tests

Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit

Sign In for Pricing
View Details
Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit
E-EL-H2072-03 96 Tests

Human CK-18/KRT18 (Cytokeratin 18) ELISA Kit

Sign In for Pricing
View Details
TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)
KN213516 1 Kit

TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details