Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHKBP1 Rabbit Polyclonal Antibody (HRP)

SHKBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sb1, PP203

UniProt

Q8TBC3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHKBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_612401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 1mg/mL
BNUM1380-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 1mg/mL

Sign In for Pricing
View Details
ZNF761 (NM_001289953) Human Tagged ORF Clone
RG235453 10 µg

ZNF761 (NM_001289953) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
gdhB Goat Polyclonal Antibody
TA396641S 25 µL

gdhB Goat Polyclonal Antibody

Sign In for Pricing
View Details