Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd12 Rabbit Polyclonal Antibody (HRP)

Kctd12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pfe, Pfet, Pfet1, Pfetin, AU046135, AW538430

UniProt

Q6WVG3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Kctd12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_808383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Peptide deformylase(def)
AP70624-01 20 µg

Recombinant Staphylococcus aureus Peptide deformylase(def)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Peptide deformylase(def)
AP70624-02 100 µg

Recombinant Staphylococcus aureus Peptide deformylase(def)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Peptide deformylase(def)
AP70624-03 1 mg

Recombinant Staphylococcus aureus Peptide deformylase(def)

Sign In for Pricing
View Details
Rat 5-Hydroxytryptamine, 5Ht Elisa Kit
EKC38584 96 Tests

Rat 5-Hydroxytryptamine, 5Ht Elisa Kit

Sign In for Pricing
View Details
BTF3 (Transcription Factor BTF3, RNA Polymerase B Transcription Factor 3, NACB, OK/SW-cl.8) (FITC)
MBS6146167-01 0.1 mL

BTF3 (Transcription Factor BTF3, RNA Polymerase B Transcription Factor 3, NACB, OK/SW-cl.8) (FITC)

Sign In for Pricing
View Details
BTF3 (Transcription Factor BTF3, RNA Polymerase B Transcription Factor 3, NACB, OK/SW-cl.8) (FITC)
MBS6146167-02 5x 0.1 mL

BTF3 (Transcription Factor BTF3, RNA Polymerase B Transcription Factor 3, NACB, OK/SW-cl.8) (FITC)

Sign In for Pricing
View Details