Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh8 Rabbit Polyclonal Antibody (HRP)

Kcnh8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ELK, ELK1, ELK3, Kv12., Kv12.1, C130090D05Rik

UniProt

P59111

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYADM (NM_001020818) Human Tagged Lenti ORF Clone
RC221290L1 10 µg

MYADM (NM_001020818) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Urocortin (UCN) activation kit by CRISPRa
GA105061 1 Kit

Human Urocortin (UCN) activation kit by CRISPRa

Sign In for Pricing
View Details
DENV (1-3) NS1 Matched Antibody Pair Set [ABP-S-07533]
ABP-S-07533 5 Plates

DENV (1-3) NS1 Matched Antibody Pair Set [ABP-S-07533]

Sign In for Pricing
View Details
SDR16C6 CRISPRa sgRNA lentivector (set of three targets)(Human)
43270121 3x 1.0µg DNA

SDR16C6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
USP48 Protein Vector (Mouse) (pPM-C-His)
PV244637 500 ng

USP48 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus Uridine kinase (udk)
MBS1087782-01 0.02 mg (E-Coli)

Recombinant Streptococcus thermophilus Uridine kinase (udk)

Sign In for Pricing
View Details