Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh8 Rabbit Polyclonal Antibody (HRP)

Kcnh8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ELK, ELK1, ELK3, Kv12., Kv12.1, C130090D05Rik

UniProt

P59111

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilms Tumor Protein, WT33) (Azide Free)
W1125-11K 100 µg

WT1 (Wilms Tumor Protein, WT33) (Azide Free)

Sign In for Pricing
View Details
Creatine Kinase B Rabbit pAb, AP conjugated
orb2875444 100 µL

Creatine Kinase B Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Fam43a (NM_001039002) Rat Tagged ORF Clone
RR213715 10 µg

Fam43a (NM_001039002) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ITM2A Polyclonal Conjugated Antibody
C27410 100 µL

ITM2A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Figf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7158105 3x 1.0 µg

Figf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
G21 protein/NPR2L Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6079R-BF488 100 µL

G21 protein/NPR2L Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details