Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh8 Rabbit Polyclonal Antibody (Biotin)

Kcnh8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ELK, ELK1, ELK3, Kv12., Kv12.1, C130090D05Rik

UniProt

P59111

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin (INS, ILPR, IRDN) (AP) discontinued
I7656-01E-AP 100 µL

Insulin (INS, ILPR, IRDN) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral human ANKRD10 shRNA (UAS) - Lentiviral human ANKRD10 shRNA (UAS, RFP) plasmid
GTR15324736 1 Vial

Lentiviral human ANKRD10 shRNA (UAS) - Lentiviral human ANKRD10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PE/Texas Red® Anti-human CD18 Antibody *HI18a*
101801S0-AAT 25 Tests

PE/Texas Red® Anti-human CD18 Antibody *HI18a*

Sign In for Pricing
View Details
Mouse Glycerol kinase 2, GK2 ELISA Kit
MBS9336417-01 48 Well

Mouse Glycerol kinase 2, GK2 ELISA Kit

Sign In for Pricing
View Details
Mouse Glycerol kinase 2, GK2 ELISA Kit
MBS9336417-02 96 Well

Mouse Glycerol kinase 2, GK2 ELISA Kit

Sign In for Pricing
View Details
Mouse Glycerol kinase 2, GK2 ELISA Kit
MBS9336417-03 5x 96 Well

Mouse Glycerol kinase 2, GK2 ELISA Kit

Sign In for Pricing
View Details