Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD18 Rabbit Polyclonal Antibody (HRP)

KCTD18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

6530404F10Rik

UniProt

Q6PI47

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl Chloromalonate
TRC-D444060-1G 1 g

Diethyl Chloromalonate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), 1mg/mL
BNUM1373-50 1x 50 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), 1mg/mL

Sign In for Pricing
View Details
Recombinant MUC1 Monoclonal Antibody
AN300416P 100 µL

Recombinant MUC1 Monoclonal Antibody

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)
HAF-443-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)

Sign In for Pricing
View Details
Psip1 Mouse Gene Knockout Kit (CRISPR)
KN514087 1 Kit

Psip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant AMPK beta 1 Antibody
RC-15483-01 50 μL

Recombinant AMPK beta 1 Antibody

Sign In for Pricing
View Details