Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD18 Rabbit Polyclonal Antibody (Biotin)

KCTD18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

6530404F10Rik

UniProt

Q6PI47

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox2d (NM_001081669) Mouse Tagged ORF Clone
MG213532 10 µg

Rhox2d (NM_001081669) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PSEN1 Adenovirus (Mouse)
37902054 1.0 mL

PSEN1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial
AP70782-01 20 µg

Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial

Sign In for Pricing
View Details
Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial
AP70782-02 100 µg

Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial

Sign In for Pricing
View Details
Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial
AP70782-03 1 mg

Recombinant Human Solute carrier family 41 member 2(SLC41A2), partial

Sign In for Pricing
View Details
14-3-3 zeta+delta Polyclonal Antibody, HRP Conjugated
bs-6790R-HRP 100 µL

14-3-3 zeta+delta Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details