Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMD2L2 Rabbit Polyclonal Antibody (HRP)

VMD2L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VMD2L2

UniProt

Q8NFU0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VMD2L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_695006

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCEE (NM_032601) Human Tagged ORF Clone Lentiviral Particle
RC205018L2V 200 µL

MCEE (NM_032601) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GALM Rabbit pAb
E45R20911N 50 ul

GALM Rabbit pAb

Sign In for Pricing
View Details
RGD1561306 3'UTR GFP Stable Cell Line
TU268369 1.0 mL

RGD1561306 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
MBS2095789-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
MBS2095789-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
MBS2095789-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Sign In for Pricing
View Details