Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2rx2 Rabbit Polyclonal Antibody (Biotin)

P2rx2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P2x, P2x2, P2X2a

UniProt

Q812E7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158306

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3116606 1.0 µg DNA

Pcdhb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ELISA kit for Porcine IL-1? (Interleukin 1 Beta)
E-EL-P0002 96 Tests

ELISA kit for Porcine IL-1? (Interleukin 1 Beta)

Sign In for Pricing
View Details
TGIF CRISPR Activation Plasmid (h)
sc-401472-ACT 20 µg

TGIF CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)
MBS2095207-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)
MBS2095207-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)
MBS2095207-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Aldolase B, Fructose Bisphosphate (ALDOB)

Sign In for Pricing
View Details