Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNN2 Rabbit Polyclonal Antibody (HRP)

KCNN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SK2, hSK2, SKCA2, KCa2.2, SKCa 2

UniProt

Q6PJI0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_740721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ashless Strengthened Filter Paper Discs M - 185mm
SLS2206 100 / PCK

Ashless Strengthened Filter Paper Discs M - 185mm

Sign In for Pricing
View Details
Mouse Clec3b Pre-designed siRNA Set A
SI102703A 1 Each

Mouse Clec3b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Gm11559 3'UTR Luciferase Stable Cell Line
TU107415 1.0 mL

Gm11559 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CHSY1 Human Over-expression Lysate
orb1368588 20 µg

CHSY1 Human Over-expression Lysate

Sign In for Pricing
View Details
Streptococcus Group A (FITC)
S7974-29C 1 mL

Streptococcus Group A (FITC)

Sign In for Pricing
View Details
Lentiviral human CRABP1 shRNA (UAS) - Lentiviral human CRABP1 shRNA (UAS) plasmid
GTR15153223 1 Vial

Lentiviral human CRABP1 shRNA (UAS) - Lentiviral human CRABP1 shRNA (UAS) plasmid

Sign In for Pricing
View Details