Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH2 Rabbit Polyclonal Antibody (Biotin)

KCNH2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERG1, HERG, LQT2, SQT1, ERG-1, H-ERG, HERG1, Kv11.1

UniProt

Q12809

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human KCNH2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742054

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A Strain A/Panama/2007/99 (H3N2) Antigen Liquid
MBS8431012-01 0.05 mg

Influenza A Strain A/Panama/2007/99 (H3N2) Antigen Liquid

Sign In for Pricing
View Details
Influenza A Strain A/Panama/2007/99 (H3N2) Antigen Liquid
MBS8431012-02 5x 0.05 mg

Influenza A Strain A/Panama/2007/99 (H3N2) Antigen Liquid

Sign In for Pricing
View Details
PLB1 Rabbit Polyclonal Antibody (FITC)
orb463258 100 µL

PLB1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
GTF3C6 3'UTR Luciferase Stable Cell Line
TU009443 1.0 mL

GTF3C6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Zfp273 shRNA (UAS) - Lentiviral mouse Zfp273 shRNA (UAS, iRFP) (100)
GTR15260511 1 Vial

Lentiviral mouse Zfp273 shRNA (UAS) - Lentiviral mouse Zfp273 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TWEAK, Recombinant, Human (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207)
T9185-01 5 µg

TWEAK, Recombinant, Human (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207)

Sign In for Pricing
View Details