Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CATSPER2 Rabbit Polyclonal Antibody (HRP)

CATSPER2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96P56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CATSPER2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_473361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF692 Rabbit Polyclonal Antibody (Cy5)
orb964824 100 µL

ZNF692 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Rno-miR-208b-5p miRNA Mimic
orb1873649-01 5 nmol

Rno-miR-208b-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-208b-5p miRNA Mimic
orb1873649-02 10 nmol

Rno-miR-208b-5p miRNA Mimic

Sign In for Pricing
View Details
Porcine CX3C-chemokine/Fractalkine ELISA Kit
MBS743919-01 48 Well

Porcine CX3C-chemokine/Fractalkine ELISA Kit

Sign In for Pricing
View Details
Porcine CX3C-chemokine/Fractalkine ELISA Kit
MBS743919-02 96 Well

Porcine CX3C-chemokine/Fractalkine ELISA Kit

Sign In for Pricing
View Details
Porcine CX3C-chemokine/Fractalkine ELISA Kit
MBS743919-03 5x 96 Well

Porcine CX3C-chemokine/Fractalkine ELISA Kit

Sign In for Pricing
View Details